PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G041700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 271aa    MW: 28902.1 Da    PI: 9.6969
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G041700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-174893147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  Sevir.5G041700.1.p 48 RGHWRPSEDAKLKELVAQHGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 93
                        899*****************************.***********996 PP

2Myb_DNA-binding56.94.7e-18100143146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
  Sevir.5G041700.1.p 100 RRAFSEEEEERLLAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHV 143
                         678*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2454394IPR017930Myb domain
SMARTSM007171.5E-144796IPR001005SANT/Myb domain
PfamPF002491.1E-164893IPR001005SANT/Myb domain
SuperFamilySSF466894.69E-2848141IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-2749101IPR009057Homeodomain-like
CDDcd001673.83E-145192No hitNo description
PROSITE profilePS5129426.7395149IPR017930Myb domain
SMARTSM007175.0E-1599147IPR001005SANT/Myb domain
PfamPF002493.5E-15100143IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-20102146IPR009057Homeodomain-like
CDDcd001676.81E-8111144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MANEMAAFFR SALPPASPAP FEEEVEDGGA DHGHGGGGGG GQGKLCARGH WRPSEDAKLK  60
ELVAQHGPQN WNLIAEKLDG RSGKSCRLRW FNQLDPRINR RAFSEEEEER LLAAHRAYGN  120
KWALIARLFP GRTDNAVKNH WHVLAARRQR EQSGTLRRRK PSSSPAQPHV VAPAAAAVHS  180
PRAHGKHHSG GESEEESAAS CTTDLSPGSA GVPFFSQSYG MVPRAAAPAS AAFAHSARSA  240
FSAPSPARHR AVASDEAALP FFDFLGVGTT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31461485107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794191e-138HF679419.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB13 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971548.21e-132PREDICTED: transcription factor MYB44-like, partial
TrEMBLK3XRZ41e-146K3XRZ4_SETIT; Uncharacterized protein
STRINGSi004691m1e-145(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.19e-55myb domain protein 105